Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00083667-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00083667-M03, RRID:AB_463944
- Product name
- SESN2 monoclonal antibody (M03), clone 3B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SESN2.
- Antigen sequence
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRES
RARRGPRGPSAFIPVEEVLREGAESLEQHLGLEAL
MSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDG
PLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTG
GDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITK
EHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSF
VFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDP
LNNSGGFESARDVEALMERMQQLQESLLRDEGTSQ
EEMESRFELEKSESLLVTPSADILEPSPHPDMLCF
VEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYS
LIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVD
TSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHV
NLLLLEARMQAALLYALRAITRYMT- Isotype
- IgG
- Antibody clone number
- 3B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The inhibition of autophagy sensitises colon cancer cells with wild-type p53 but not mutant p53 to topotecan treatment.
Association of platelet-derived growth factor receptor β accumulation with increased oxidative stress and cellular injury in sestrin 2 silenced human glioblastoma cells.
Li DD, Sun T, Wu XQ, Chen SP, Deng R, Jiang S, Feng GK, Pan JX, Zhang XS, Zeng YX, Zhu XF
PloS one 2012;7(9):e45058
PloS one 2012;7(9):e45058
Association of platelet-derived growth factor receptor β accumulation with increased oxidative stress and cellular injury in sestrin 2 silenced human glioblastoma cells.
Liu SY, Lee YJ, Lee TC
FEBS letters 2011 Jun 23;585(12):1853-8
FEBS letters 2011 Jun 23;585(12):1853-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SESN2 expression in transfected 293T cell line by SESN2 monoclonal antibody (M03), clone 3B8.Lane 1: SESN2 transfected lysate(54.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SESN2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SES2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of SESN2 transfected lysate using anti-SESN2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SESN2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SESN2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol