Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005753-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005753-B01P, RRID:AB_1579343
- Product name
- PTK6 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human PTK6 protein.
- Antigen sequence
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVF
HVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAER
ETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIR
VSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLN
EAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEP
EPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLW
KDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHK
HILALYAVVSVGDPVYIITELMAKGSLLELLRDSD
EKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAA
RNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIP
YKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQ
VPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Marine natural products-inspired phenylmethylene hydantoins with potent in vitro and in vivo antitumor activities via suppression of Brk and FAK signaling.
Optimization, pharmacophore modeling and 3D-QSAR studies of sipholanes as breast cancer migration and proliferation inhibitors.
The marine-derived sipholenol A-4-O-3',4'-dichlorobenzoate inhibits breast cancer growth and motility in vitro and in vivo through the suppression of Brk and FAK signaling.
Sallam AA, Mohyeldin MM, Foudah AI, Akl MR, Nazzal S, Meyer SA, Liu YY, El Sayed KA
Organic & biomolecular chemistry 2014 Jul 28;12(28):5295-303
Organic & biomolecular chemistry 2014 Jul 28;12(28):5295-303
Optimization, pharmacophore modeling and 3D-QSAR studies of sipholanes as breast cancer migration and proliferation inhibitors.
Foudah AI, Sallam AA, Akl MR, El Sayed KA
European journal of medicinal chemistry 2014 Feb 12;73:310-24
European journal of medicinal chemistry 2014 Feb 12;73:310-24
The marine-derived sipholenol A-4-O-3',4'-dichlorobenzoate inhibits breast cancer growth and motility in vitro and in vivo through the suppression of Brk and FAK signaling.
Akl MR, Foudah AI, Ebrahim HY, Meyer SA, El Sayed KA
Marine drugs 2014 Apr 14;12(4):2282-304
Marine drugs 2014 Apr 14;12(4):2282-304
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PTK6 expression in transfected 293T cell line (H00005753-T01) by PTK6 MaxPab polyclonal antibody.Lane 1: PTK6 transfected lysate(49.61 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PTK6 MaxPab polyclonal antibody. Western Blot analysis of PTK6 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to PTK6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol