HPA073666

antibody from Atlas Antibodies

Targeting: SRI

Antibody data

Submit

Validation data

Product number: HPA073666 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA073666, RRID:AB_2686623
Product name: Anti-SRI
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRL SPQAVNSIAKRYSTNGKITFDDYI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SRI protein structure - HPA073666 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human rectum and skeletal muscle tissues using Anti-SRI antibody. Corresponding SRI RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, rectum and skeletal muscle using Anti-SRI antibody HPA073666 (A) shows similar protein distribution across tissues to independent antibody HPA019004 (B).
Antibody #2 product nr: HPA019004
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-SRI antibody HPA073666.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SRI antibody HPA073666.
Sample type: HUMAN