Explore
Validate
LearnH00084196-M01
antibody from Abnova Corporation
Targeting: USP48
FLJ11328, FLJ20103, FLJ23054, FLJ23277, MGC14879, USP31
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084196-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084196-M01, RRID:AB_489850
- Product name
- USP48 monoclonal antibody (M01), clone 3G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant USP48.
- Antigen sequence
NLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTI
CEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQ
QDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFC
GEYAY- Isotype
- IgG
- Antibody clone number
- 3G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- USP48 monoclonal antibody (M01), clone 3G4 Western Blot analysis of USP48 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged USP48 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to USP48 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
