Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006903-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006903-M04, RRID:AB_1112167
- Product name
- TBCC monoclonal antibody (M04), clone 3D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant TBCC.
- Antigen sequence
MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQE
RQLEVERRKQKRQNQEVEKENSHFFVATFARERAA
VEELLERAESVERLEEAASRLQGLQKLINDSVFFL
AAYDLRQGQEALARLQAALAERRRGLQPKKRFAFK
TRGKDAASSTKVDAAPGIPPAVESIQDSPLPKKAE
GDLGPSWVCGFSNLESQVLEKRASELHQRDVLLTE
LSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVF
LEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI
VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNW
NDVDDFNWLARDMASPNWSILPEEERNIQWD- Isotype
- IgG
- Antibody clone number
- 3D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The solution structure of the N-terminal domain of human tubulin binding cofactor C reveals a platform for tubulin interaction.
Silencing of tubulin binding cofactor C modifies microtubule dynamics and cell cycle distribution and enhances sensitivity to gemcitabine in breast cancer cells.
Tubulin binding cofactor C (TBCC) suppresses tumor growth and enhances chemosensitivity in human breast cancer cells.
Garcia-Mayoral MF, CastaƱo R, Fanarraga ML, Zabala JC, Rico M, Bruix M
PloS one 2011;6(10):e25912
PloS one 2011;6(10):e25912
Silencing of tubulin binding cofactor C modifies microtubule dynamics and cell cycle distribution and enhances sensitivity to gemcitabine in breast cancer cells.
Hage-Sleiman R, Herveau S, Matera EL, Laurier JF, Dumontet C
Molecular cancer therapeutics 2011 Feb;10(2):303-12
Molecular cancer therapeutics 2011 Feb;10(2):303-12
Tubulin binding cofactor C (TBCC) suppresses tumor growth and enhances chemosensitivity in human breast cancer cells.
Hage-Sleiman R, Herveau S, Matera EL, Laurier JF, Dumontet C
BMC cancer 2010 Apr 12;10:135
BMC cancer 2010 Apr 12;10:135
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TBCC is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TBCC on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol