Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005859-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005859-M01, RRID:AB_535001
- Product name
- QARS monoclonal antibody (M01), clone 5F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant QARS.
- Antigen sequence
FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGF
LSDLNLASLHVVDAALVDCSVALAKPFDKFQFERL
GYFSVDPDSHQGKLVFNRTVTLKEDPGKV- Isotype
- IgG
- Antibody clone number
- 5F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L
Neoplasia (New York, N.Y.) 2009 Nov;11(11):1194-207
Neoplasia (New York, N.Y.) 2009 Nov;11(11):1194-207
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- QARS monoclonal antibody (M01), clone 5F5 Western Blot analysis of QARS expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of QARS expression in transfected 293T cell line by QARS monoclonal antibody (M01), clone 5F5.Lane 1: QARS transfected lysate(87.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged QARS is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of QARS transfected lysate using anti-QARS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with QARS MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to QARS on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol