HPA041327

antibody from Atlas Antibodies

Targeting: ZC3H18 NHN1

Antibody data

Submit

Validation data

Product number: HPA041327 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041327, RRID:AB_10795005
Product name: Anti-ZC3H18
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRI PRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZC3H18 protein structure - HPA041327 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ZC3H18 antibody HPA041327 (A) shows similar protein distribution across tissues to independent antibody HPA040847 (B).
Antibody #2 product nr: HPA040847
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ZC3H18 antibody HPA041327.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ZC3H18 antibody HPA041327.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ZC3H18 antibody HPA041327.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ZC3H18 antibody HPA041327.
Sample type: HUMAN