ARP37513_P050

antibody from Aviva Systems Biology

Targeting: LCOR C10orf12, DKFZP564P1916, FLJ13022, FLJ38026, KIAA1795, MLR2

Antibody data

Submit

Validation data

Product number: ARP37513_P050 - Provider product page
Provider: Aviva Systems Biology
Proper citation: Aviva Systems Biology Cat#ARP37513_P050, RRID:AB_2297035
Product name: A630025C20RIK antibody - N-terminal region (ARP37513_P050)
Antibody type: Polyclonal
Antigen: Synthetic peptide
Description: This is a rabbit polyclonal antibody against A630025C20RIK. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Reactivity: Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host: Rabbit
Antigen sequence: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVT TSPTAATTQNPVLSK
Vial size: 50 µg
Concentration: 1 mg/ml
Handling: Add 50 µl of distilled water. Final anti-A630025C20RIK antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

LCOR protein structure - ARP37513_P050 shown in red.