HPA050507

antibody from Atlas Antibodies

Targeting: EPX EPO, EPP, EPX-PEN

Antibody data

Submit

Validation data

Product number: HPA050507 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA050507, RRID:AB_2681149
Product name: Anti-EPX
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQ KS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EPX protein structure - HPA050507 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using HPA050507 antibody. Corresponding EPX RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows strong positivity in a subset of cells in the red pulp.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in some peripheral leukocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN