HPA042513

antibody from Atlas Antibodies

Targeting: TEX101 CT131, MGC4766, SGRG, SPATA44, TES101RP

Antibody data

Submit

Validation data

Product number: HPA042513 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042513, RRID:AB_10795507
Product name: Anti-TEX101
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VTSYSNYCEDSFCNDKDSLSQFWEFSETTASTVST TLHCPTCVALGTCFSAPSLPCPNGTTRCYQGKLEI TG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TEX101 protein structure - HPA042513 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using Anti-TEX101 antibody. Corresponding TEX101 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, testis and tonsil using Anti-TEX101 antibody HPA042513 (A) shows similar protein distribution across tissues to independent antibody HPA041915 (B).
Antibody #2 product nr: HPA041915
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil using Anti-TEX101 antibody HPA042513.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-TEX101 antibody HPA042513.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TEX101 antibody HPA042513.
Sample type: HUMAN