Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028580 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028580, RRID:AB_10601913
- Product name
- Anti-MATN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REIASEPVAEHYFYTADFKTINQIGKKLQKKICVE
EDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLA
ILENTVV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Loss of matrilin 1 does not exacerbate the skeletal phenotype in a mouse model of multiple epiphyseal dysplasia caused by a Matn3 V194D mutation
Bell P, PirĂ³g K, Fresquet M, Thornton D, Boot-Handford R, Briggs M
Arthritis & Rheumatism 2012 May;64(5):1529-1539
Arthritis & Rheumatism 2012 May;64(5):1529-1539
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human soft tissue shows nuclear and cytoplasmic positivity in chondrocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human soft tissues shows strong cytoplasmic positivity in chondrocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
- Sample type
- HUMAN