Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006637-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006637-M01, RRID:AB_425688
- Product name
- SNRPG monoclonal antibody (M01), clone 2H8-1C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SNRPG.
- Antigen sequence
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFD
PFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML
EALERV- Isotype
- IgG
- Antibody clone number
- 2H8-1C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SNRPG monoclonal antibody (M01), clone 2H8-1C12 Western Blot analysis of SNRPG expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SNRPG expression in transfected 293T cell line by SNRPG monoclonal antibody (M01), clone 2H8-1C12.Lane 1: SNRPG transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.