Explore
Validate
LearnH00000537-M01
antibody from Abnova Corporation
Targeting: ATP6AP1
16A, Ac45, ATP6IP1, ATP6S1, CF2, ORF, VATPS1, XAP-3, XAP3
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000537-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000537-M01, RRID:AB_509162
- Product name
- ATP6AP1 monoclonal antibody (M01), clone 3A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP6AP1.
- Antigen sequence
SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELG
PRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNL
ENALDLAPSSLVLPAVDWYAVSTLTTYLQE- Isotype
- IgG
- Antibody clone number
- 3A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Vacuolar H(+)-ATPase subunits Voa1 and Voa2 cooperatively regulate secretory vesicle acidification, transmitter uptake, and storage.
Saw NM, Kang SY, Parsaud L, Han GA, Jiang T, Grzegorczyk K, Surkont M, Sun-Wada GH, Wada Y, Li L, Sugita S
Molecular biology of the cell 2011 Sep;22(18):3394-409
Molecular biology of the cell 2011 Sep;22(18):3394-409
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody (M01), clone 3A2.Lane 1: ATP6AP1 transfected lysate(52 KDa).Lane 2: Non-transfected lysate.
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ATP6AP1 monoclonal antibody (M01), clone 3A2. Western Blot analysis of ATP6AP1 expression in PC-12 ( Cat # L012V1 ).
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ATP6AP1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
