HPA029939

antibody from Atlas Antibodies

Targeting: EIF3I eIF3-beta, eIF3-p36, EIF3S2, TRIP-1

Antibody data

Submit

Validation data

Product number: HPA029939 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029939, RRID:AB_10611109
Product name: Anti-EIF3I
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKIT SAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVK EHSRQINDIQLSRD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EIF3I protein structure - HPA029939 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, endometrium, rectum and testis using Anti-EIF3I antibody HPA029939 (A) shows similar protein distribution across tissues to independent antibody HPA029940 (B).
Antibody #2 product nr: HPA029940
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex strong cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN