Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031381 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031381, RRID:AB_10601885
- Product name
- Anti-DDX43
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIRE
EGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEA
DSWR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references HAGE (DDX43) is a biomarker for poor prognosis and a predictor of chemotherapy response in breast cancer.
Abdel-Fatah TM, McArdle SE, Johnson C, Moseley PM, Ball GR, Pockley AG, Ellis IO, Rees RC, Chan SY
British journal of cancer 2014 May 13;110(10):2450-61
British journal of cancer 2014 May 13;110(10):2450-61
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and endometrium tissues using Anti-DDX43 antibody. Corresponding DDX43 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN