Explore
Validate
LearnH00009221-M02
antibody from Abnova Corporation
Targeting: NOLC1
KIAA0035, NOPP130, NOPP140, P130, Srp40
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009221-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009221-M02, RRID:AB_566024
- Product name
- NOLC1 monoclonal antibody (M02), clone 6B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NOLC1.
- Antigen sequence
EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSP
FRRVREEEIEVDSRVADNSFDAKRGAAGDWGERAN
QVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSI
KFDSE- Isotype
- IgG
- Antibody clone number
- 6B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NOLC1 monoclonal antibody (M02), clone 6B4 Western Blot analysis of NOLC1 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NOLC1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to NOLC1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
