Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15702 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15702, RRID:AB_10677570
- Product name
- Kcnd2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Kcnd2 (Cerebellum, Granule cell).
- Antigen sequence
YMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQH
HHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPS
SHRPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGS
HRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEEC
VKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPE
YSGGNIVRVSAL- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Mutations in the genes KCND2 and KCND3 encoding the ion channels Kv4.2 and Kv4.3, conducting the cardiac fast transient outward current (ITO,f), are not a frequent cause of long QT syndrome.
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Frank-Hansen R, Larsen LA, Andersen P, Jespersgaard C, Christiansen M
Clinica chimica acta; international journal of clinical chemistry 2005 Jan;351(1-2):95-100
Clinica chimica acta; international journal of clinical chemistry 2005 Jan;351(1-2):95-100
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
No comments: Submit comment
No validations: Submit validation data