Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109209 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N terminal of human TCF7L1
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSL
VNESENQSSSSDSEA- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK
Nature 2005 Apr 7;434(7034):724-31
Nature 2005 Apr 7;434(7034):724-31
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human 293T; WB Suggested Anti-TCF7L1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate; TCF7L1 antibody - N-terminal region (AP44003PU-N) in Human 293T cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Skin; Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0ug/ml using anti-TCF7L1 antibody (AP44003PU-N); TCF7L1 antibody - N-terminal region (AP44003PU-N) in Human Skin cells using Immunohistochemistry