Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051703-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051703-M01, RRID:AB_509241
- Product name
- ACSL5 monoclonal antibody (M01), clone 5H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACSL5.
- Antigen sequence
PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSC
CFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYR
WLSYKQVSDRAEYLGSCLLHKGYKSS- Isotype
- IgG
- Antibody clone number
- 5H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Modulating effects of acyl-CoA synthetase 5-derived mitochondrial Wnt2B palmitoylation on intestinal Wnt activity.
TP53 status regulates ACSL5-induced expression of mitochondrial mortalin in enterocytes and colorectal adenocarcinomas.
Gene expression profiling in sinonasal adenocarcinoma.
Promotion of glioma cell survival by acyl-CoA synthetase 5 under extracellular acidosis conditions.
Klaus C, Schneider U, Hedberg C, Schütz AK, Bernhagen J, Waldmann H, Gassler N, Kaemmerer E
World journal of gastroenterology 2014 Oct 28;20(40):14855-64
World journal of gastroenterology 2014 Oct 28;20(40):14855-64
TP53 status regulates ACSL5-induced expression of mitochondrial mortalin in enterocytes and colorectal adenocarcinomas.
Klaus C, Kaemmerer E, Reinartz A, Schneider U, Plum P, Jeon MK, Hose J, Hartmann F, Schnölzer M, Wagner N, Kopitz J, Gassler N
Cell and tissue research 2014 Jul;357(1):267-78
Cell and tissue research 2014 Jul;357(1):267-78
Gene expression profiling in sinonasal adenocarcinoma.
Tripodi D, Quéméner S, Renaudin K, Ferron C, Malard O, Guisle-Marsollier I, Sébille-Rivain V, Verger C, Géraut C, Gratas-Rabbia-Ré C
BMC medical genomics 2009 Nov 10;2:65
BMC medical genomics 2009 Nov 10;2:65
Promotion of glioma cell survival by acyl-CoA synthetase 5 under extracellular acidosis conditions.
Mashima T, Sato S, Sugimoto Y, Tsuruo T, Seimiya H
Oncogene 2009 Jan 8;28(1):9-19
Oncogene 2009 Jan 8;28(1):9-19
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ACSL5 monoclonal antibody (M01), clone 5H8 Western Blot analysis of ACSL5 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody (M01), clone 5H8.Lane 1: ACSL5 transfected lysate(82.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ACSL5 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ACSL5 transfected lysate using anti-ACSL5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ACSL5 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol