ABIN405464
antibody from antibodies-online
Targeting: ATP6V0A2
a2, ATP6a2, ATP6N1D, J6B7, Stv1, TJ6, TJ6M, TJ6s, Vph1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405464 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEV
ELREV TKNKEKLRKN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Impaired glycosylation and cutis laxa caused by mutations in the vesicular H+-ATPase subunit ATP6V0A2.
Kornak U, Reynders E, Dimopoulou A, van Reeuwijk J, Fischer B, Rajab A, Budde B, Nürnberg P, Foulquier F, ARCL Debré-type Study Group, Lefeber D, Urban Z, Gruenewald S, Annaert W, Brunner HG, van Bokhoven H, Wevers R, Morava E, Matthijs G, Van Maldergem L, Mundlos S
Nature genetics 2008 Jan;40(1):32-4
Nature genetics 2008 Jan;40(1):32-4
No comments: Submit comment
No validations: Submit validation data