Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004725-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004725-D01P, RRID:AB_1677010
- Product name
- NDUFS5 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human NDUFS5 protein.
- Antigen sequence
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHA
FEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQ
KTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPR
P- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NDUFS5 expression in transfected 293T cell line (H00004725-T02) by NDUFS5 MaxPab polyclonal antibody.Lane 1: NDUFS5 transfected lysate(12.50 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NDUFS5 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFS5 expression in human liver.