Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310121 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Eukaryotic Translation Initiation Factor 4E Family Member 3 (EIF4E3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EIF4E3 antibody: synthetic peptide directed towards the middle region of human EIF4E3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYK
PHEEH HAFEGGRGKH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Hypoxia-inducible factor-1α (HIF-1α) promotes cap-dependent translation of selective mRNAs through up-regulating initiation factor eIF4E1 in breast cancer cells under hypoxia conditions.
Yi T, Papadopoulos E, Hagner PR, Wagner G
The Journal of biological chemistry 2013 Jun 28;288(26):18732-42
The Journal of biological chemistry 2013 Jun 28;288(26):18732-42
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting