AMAb91582

antibody from Atlas Antibodies

Targeting: ATG5 APG5, APG5L, ASP, hAPG5

Antibody data

Submit

Validation data

Product number: AMAb91582 - Provider product page
Provider: Atlas Antibodies
Product name: Anti-ATG5
Antibody type: Monoclonal
Reactivity: Human
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: MSCMKEADALKHKSQVINEMQKKDHKQLWMGLQND RFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTE RPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPE DGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFL
Epitope: Binds to an epitope located within the peptide sequence MLETPLQWLS as determined by overlapping synthetic peptides.
Isotype: IgG
Antibody clone number: CL9508
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ATG5 protein structure - AMAb91582 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human prostate and skeletal muscle tissues using AMAb91582 antibody. Corresponding ATG5 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate cancer shows moderate cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.