Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011101-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011101-A01, RRID:AB_463421
- Product name
- ATE1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ATE1.
- Antigen sequence
MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSN
GMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQT
CCPQYTIRCRPLQFQPS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The N-end rule pathway is a sensor of heme.
Hu RG, Wang H, Xia Z, Varshavsky A
Proceedings of the National Academy of Sciences of the United States of America 2008 Jan 8;105(1):76-81
Proceedings of the National Academy of Sciences of the United States of America 2008 Jan 8;105(1):76-81
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ATE1 polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of ATE1 expression in HeLa ( Cat # L013V1 ).