Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040155 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA040155, RRID:AB_10793957
- Product name
- Anti-MAST2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGN
LASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNL
VRMRNQS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A functional yeast survival screen of tumor-derived cDNA libraries designed to identify anti-apoptotic mammalian oncogenes.
Eißmann M, Schwamb B, Melzer IM, Moser J, Siele D, Köhl U, Rieker RJ, Wachter DL, Agaimy A, Herpel E, Baumgarten P, Mittelbronn M, Rakel S, Kögel D, Böhm S, Gutschner T, Diederichs S, Zörnig M
PloS one 2013;8(5):e64873
PloS one 2013;8(5):e64873
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
- Sample type
- HUMAN