Home > Search result > ENPP3 > HPA043772

HPA043772

antibody from Atlas Antibodies

Targeting: ENPP3 B10, CD203c, gp130RB13-6, PD-IBETA, PDNP3

Provider product page for HPA043772

Immunohistochemistry

Antibody data

Antibody Data
Antigen structure
References [0]
Comments [0]
Validations
Immunohistochemistry [9]

Submit

Validation data

Product number: HPA043772 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043772, RRID:AB_10795616
Product name: Anti-ENPP3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGN HGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ENPP3 protein structure - HPA043772 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and placenta tissues using HPA043772 antibody. Corresponding ENPP3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human uterus shows distinct membranous positivity in glandular cells with extracellular staining.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human seminal vesicle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows weak membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells.
Sample type: HUMAN