Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32327 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- SECTM1 Antibody
- Antibody type
- Polyclonal
- Antigen
- Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.
- Description
- Antigen affinity
- Reactivity
- Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the SECTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of mouse HEPA cell lysate with SECTM1 antibody. Expected/observed molecular weight ~23 kDa.