HPA035829

antibody from Atlas Antibodies

Targeting: PPP2R3A PPP2R3, PR130, PR72

Antibody data

Submit

Validation data

Product number: HPA035829 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA035829, RRID:AB_10696513
Product name: Anti-PPP2R3A
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVA EESAQAQFQEGFEDYETDEPASPSEFGNKSNKILS ASLPEKCGKLQSVDEE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PPP2R3A protein structure - HPA035829 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PPP2R3A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines A-431 and HeLa using Anti-PPP2R3A antibody. Corresponding PPP2R3A RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.