HPA052787

antibody from Atlas Antibodies

Targeting: CLCA1 CaCC, CLCRG1

Antibody data

Submit

Validation data

Product number: HPA052787 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA052787, RRID:AB_2681947
Product name: Anti-CLCA1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VGMVTFDSAAHVQSELIQINSGSDRDTLAKRLPAA ASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CLCA1 protein structure - HPA052787 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and liver tissues using Anti-CLCA1 antibody. Corresponding CLCA1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, small intestine and testis using Anti-CLCA1 antibody HPA052787 (A) shows similar protein distribution across tissues to independent antibody HPA059301 (B).
Antibody #2 product nr: HPA059301
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CLCA1 antibody HPA052787.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CLCA1 antibody HPA052787.
Sample type: HUMAN