Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310221 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ornithine Carbamoyltransferase (OTC) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-OTC antibody: synthetic peptide directed towards the N terminal of human OTC
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKN
FTGEE IKYMLWLSAD- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sirt3 promotes the urea cycle and fatty acid oxidation during dietary restriction.
Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals.
Hyperammonemia-induced encephalopathy due to ornithine transcarbamylase deficiency in an adult woman: identification of novel missense mutations.
Hallows WC, Yu W, Smith BC, Devries MK, Ellinger JJ, Someya S, Shortreed MR, Prolla T, Markley JL, Smith LM, Zhao S, Guan KL, Denu JM
Molecular cell 2011 Jan 21;41(2):139-49
Molecular cell 2011 Jan 21;41(2):139-49
Lysine 88 acetylation negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals.
Yu W, Lin Y, Yao J, Huang W, Lei Q, Xiong Y, Zhao S, Guan KL
The Journal of biological chemistry 2009 May 15;284(20):13669-75
The Journal of biological chemistry 2009 May 15;284(20):13669-75
Hyperammonemia-induced encephalopathy due to ornithine transcarbamylase deficiency in an adult woman: identification of novel missense mutations.
Tanaka A, Wada T, Maruyama M, Tanaka A, Takikawa H, Komatsu Y
Journal of gastroenterology 2005 Jan;40(1):106-7
Journal of gastroenterology 2005 Jan;40(1):106-7
No comments: Submit comment
No validations: Submit validation data