HPA032027

antibody from Atlas Antibodies

Targeting: ABCD3 PMP70, PXMP1, ZWS2

Antibody data

Submit

Validation data

Product number: HPA032027 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA032027, RRID:AB_10602103
Product name: Anti-ABCD3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHM DGRGNYEFKQITEDTVEFGS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ABCD3 protein structure - HPA032027 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and skeletal muscle tissues using Anti-ABCD3 antibody. Corresponding ABCD3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and skeletal muscle using Anti-ABCD3 antibody HPA032027 (A) shows similar protein distribution across tissues to independent antibody HPA032026 (B).
Antibody #2 product nr: HPA032026
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ABCD3 antibody HPA032027.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ABCD3 antibody HPA032027.
Sample type: HUMAN