AMAb90995

antibody from Atlas Antibodies

Targeting: ABCD3 PMP70, PXMP1, ZWS2

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

AMAb90995

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#AMAb90995, RRID:AB_2665755

Product name

Anti-ABCD3

Antibody type

Monoclonal

Reactivity

Human

Host

Mouse

Conjugate

Unconjugated

Antigen sequence

MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDH
VPLATPNGDVLIRDLNFEVRSGANVLICGP


Epitope

Binds to an epitope located within the peptide sequence GVQVIPLIPGAGEII as determined by overlapping synthetic peptides.

Isotype

IgG

Antibody clone number

CL2524

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining in HeLa cell line with Anti-ABCD3 monoclonal antibody, showing specific staining of peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining in A431 cell line with Anti-ABCD3 monoclonal antibody, showing specific staining of peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining in MCF7 cell line with Anti-ABCD3 monoclonal antibody, showing specific staining of peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining in U2OS cell line with Anti-ABCD3 monoclonal antibody, showing specific staining of peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining in U251 cell line with Anti-ABCD3 monoclonal antibody, showing specific staining of peroxisomes in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Sample type

HUMAN

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human liver and pancreas tissues using AMAb90995 antibody. Corresponding ABCD3 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human rectum shows strong granular cytoplasmic immunoreactivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human prostate shows granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows strong granular cytoplasmic immunoreactivity in hepatocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human kidney shows strong granular cytoplasmic immunoreactivity in renal tubules.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human small intestine shows strong granular cytoplasmic immunoreactivity in the glandular epithelium.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.