Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000271-M04A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000271-M04A, RRID:AB_1571178
- Product name
- AMPD2 monoclonal antibody (M04A), clone 2G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AMPD2.
- Antigen sequence
ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQG
EGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTD
LLDAAKSVVRALFIREKYMALSLQSFCPTT- Isotype
- IgG
- Antibody clone number
- 2G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Effects of pharmacological AMP deaminase inhibition and Ampd1 deletion on nucleotide levels and AMPK activation in contracting skeletal muscle.
Uric acid-dependent inhibition of AMP kinase induces hepatic glucose production in diabetes and starvation: evolutionary implications of the uricase loss in hominids.
Plaideau C, Lai YC, Kviklyte S, Zanou N, Löfgren L, Andersén H, Vertommen D, Gailly P, Hue L, Bohlooly-Y M, Hallén S, Rider MH
Chemistry & biology 2014 Nov 20;21(11):1497-1510
Chemistry & biology 2014 Nov 20;21(11):1497-1510
Uric acid-dependent inhibition of AMP kinase induces hepatic glucose production in diabetes and starvation: evolutionary implications of the uricase loss in hominids.
Cicerchi C, Li N, Kratzer J, Garcia G, Roncal-Jimenez CA, Tanabe K, Hunter B, Rivard CJ, Sautin YY, Gaucher EA, Johnson RJ, Lanaspa MA
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Aug;28(8):3339-50
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2014 Aug;28(8):3339-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M04A), clone 2G8.Lane 1: AMPD2 transfected lysate(92.1 KDa).Lane 2: Non-transfected lysate.