Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002934-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002934-M01, RRID:AB_606338
- Product name
- GSN monoclonal antibody (M01), clone 3G5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GSN.
- Antigen sequence
SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQV
FVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRT
PITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAM
AELAA- Isotype
- IgG
- Antibody clone number
- 3G5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GSN monoclonal antibody (M01), clone 3G5 Western Blot analysis of GSN expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GSN expression in transfected 293T cell line by GSN monoclonal antibody (M01), clone 3G5.Lane 1: GSN transfected lysate(85.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GSN is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of GSN transfected lysate using anti-GSN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GSN MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to GSN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol