Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010000-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010000-M08, RRID:AB_509284
- Product name
- AKT3 monoclonal antibody (M08), clone 6E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AKT3.
- Antigen sequence
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMD
ASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKA
SGKYYAMKILKKEVIIAKDE- Isotype
- IgG
- Antibody clone number
- 6E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AKT3 monoclonal antibody (M08), clone 6E11. Western Blot analysis of AKT3 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AKT3 expression in transfected 293T cell line by AKT3 monoclonal antibody (M08), clone 6E11.Lane 1: AKT3 transfected lysate(55.8 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AKT3 monoclonal antibody (M08), clone 6E11. Western Blot analysis of AKT3 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AKT3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PRKCZ and AKT3. HeLa cells were stained with anti-PRKCZ rabbit purified polyclonal 1:1200 and anti-AKT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
