Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001981-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001981-M10, RRID:AB_606171
- Product name
- EIF4G1 monoclonal antibody (M10), clone 2A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
- Antigen sequence
DVAVLKARAKLLQKYLCDEQKELQALYALQALVVT
LEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDP
AEQQGKGVALKSVTAFFKWLREAEEESDHN- Isotype
- IgG
- Antibody clone number
- 2A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EIF4G1 expression in transfected 293T cell line by EIF4G1 monoclonal antibody (M10), clone 2A9.Lane 1: EIF4G1 transfected lysate(70.95 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- EIF4G1 monoclonal antibody (M10), clone 2A9. Western Blot analysis of EIF4G1 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EIF4G1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to EIF4G1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
