HPA031849

antibody from Atlas Antibodies

Targeting: PLCL1 PLC-L, PLCE, PLCL, PPP1R127, PRIP

Antibody data

Submit

Validation data

Product number: HPA031849 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031849, RRID:AB_10602192
Product name: Anti-PLCL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAAD VDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEI QKSKEKLTTRVTEEEF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PLCL1 protein structure - HPA031849 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and lung tissues using HPA031849 antibody. Corresponding PLCL1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity, with a granular pattern in renal tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows weak to moderate cytoplasmic positivity in pneumocytes and in macrophages.
Sample type: HUMAN