Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006273-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006273-M03, RRID:AB_464039
- Product name
- S100A2 monoclonal antibody (M03), clone 3H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant S100A2.
- Antigen sequence
MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMK
ELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQV
DFQEYAVFLALITVMCNDFFQGCPDRP- Isotype
- IgG
- Antibody clone number
- 3H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- S100A2 monoclonal antibody (M03), clone 3H8 Western Blot analysis of S100A2 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of S100A2 expression in transfected 293T cell line by S100A2 monoclonal antibody (M03), clone 3H8.Lane 1: S100A2 transfected lysate(11 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged S100A2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to S100A2 on A-431 cell. [antibody concentration 15 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol