Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006284-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006284-M01, RRID:AB_530194
- Product name
- S100A13 monoclonal antibody (M01), clone 3A7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant S100A13.
- Antigen sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSV
NEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE
LKFNEYWRLIGELAKEIRKKKDLKIRKK- Isotype
- IgG
- Antibody clone number
- 3A7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- S100A13 monoclonal antibody (M01), clone 3A7 Western Blot analysis of S100A13 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody (M01), clone 3A7.Lane 1: S100A13 transfected lysate(11.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged S100A13 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to S100A13 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
