Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503351 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcriptional Adaptor 1 (TADA1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TADA1L antibody: synthetic peptide directed towards the C terminal of human TADA1L
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
REVIPTHTVYALNIERIITKLWHPNHEELQQDKVH
RQRLA AKEGLLLC- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo.
Martinez E, Palhan VB, Tjernberg A, Lymar ES, Gamper AM, Kundu TK, Chait BT, Roeder RG
Molecular and cellular biology 2001 Oct;21(20):6782-95
Molecular and cellular biology 2001 Oct;21(20):6782-95
No comments: Submit comment
No validations: Submit validation data