HPA000288

antibody from Atlas Antibodies

Targeting: ACE2

Western blot

Antibody data

Submit

Validation data

Product number: HPA000288 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA000288, RRID:AB_1078160
Product name: Anti-ACE2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHE AEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWS AFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGS SVLSED
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ACE2 protein structure - HPA000288 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and tonsil tissues using HPA000288 antibody. Corresponding ACE2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong positivity in apical membranes in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong positivity in apical membranes in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong positivity in apical membrane in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
Sample type: HUMAN