HPA056433

antibody from Atlas Antibodies

Targeting: TEX44 C2orf57, MGC35154

Antibody data

Submit

Validation data

Product number: HPA056433 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA056433, RRID:AB_2683131
Product name: Anti-TEX44
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQ HMEAQPVESDADHVTAGANGQHGPQAASTTKSAEE KAEHP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TEX44 protein structure - HPA056433 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and kidney tissues using Anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-TEX44 antibody HPA056433 (A) shows similar protein distribution across tissues to independent antibody HPA049917 (B).
Antibody #2 product nr: HPA049917
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TEX44 antibody HPA056433.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-TEX44 antibody HPA056433.
Sample type: HUMAN