HPA002476

antibody from Atlas Antibodies

Targeting: ABCC4 EST170205, MOAT-B, MOATB, MRP4

Antibody data

Submit

Validation data

Product number: HPA002476 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002476, RRID:AB_1844434
Product name: Anti-ABCC4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NFSVGQRQLVCLARAILRKNQILIIDEATANVDPR TDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIM VLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAE AAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQP ST
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ABCC4 protein structure - HPA002476 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human prostate and liver tissues using HPA002476 antibody. Corresponding ABCC4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
Sample type: HUMAN