Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Chromatin Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503176 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SET and MYND Domain Containing 2 (SMYD2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHG
KDHPY ISEIKQEIES- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The tale of two domains: proteomics and genomics analysis of SMYD2, a new histone methyltransferase.
Primary central nervous system lymphoma in Japan: changes in clinical features, treatment, and prognosis during 1985-2004.
Abu-Farha M, Lambert JP, Al-Madhoun AS, Elisma F, Skerjanc IS, Figeys D
Molecular & cellular proteomics : MCP 2008 Mar;7(3):560-72
Molecular & cellular proteomics : MCP 2008 Mar;7(3):560-72
Primary central nervous system lymphoma in Japan: changes in clinical features, treatment, and prognosis during 1985-2004.
Shibamoto Y, Ogino H, Suzuki G, Takemoto M, Araki N, Isobe K, Tsuchida E, Nakamura K, Kenjo M, Suzuki K, Hosono M, Tokumaru S, Ishihara S, Kato E, Ii N, Hayabuchi N
Neuro-oncology 2008 Aug;10(4):560-8
Neuro-oncology 2008 Aug;10(4):560-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- ChIP