HPA043443

antibody from Atlas Antibodies

Targeting: CCSAP C1orf96, CSAP, FLJ41471

Antibody data

Submit

Validation data

Product number: HPA043443 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043443, RRID:AB_2678485
Product name: Anti-CCSAP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQ TRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQ RSSSKIKENKHPFALYGW
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CCSAP protein structure - HPA043443 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CCSAP antibody. Corresponding CCSAP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-CCSAP antibody HPA043443 (A) shows similar protein distribution across tissues to independent antibody HPA028402 (B).
Antibody #2 product nr: HPA028402
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CCSAP antibody HPA043443.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum using Anti-CCSAP antibody HPA043443.
Sample type: HUMAN