Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN633658 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Channel Tetramerisation Domain Containing 7 (KCTD7) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE
- Description
- Affinity purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
No validations: Submit validation data