Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023088 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023088, RRID:AB_1857227
- Product name
- Anti-SLIT2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGT
CQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKC
VHGTCLPINAFSYSCKCLE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Loss of Expression and Promoter Methylation of SLIT2 Are Associated with Sessile Serrated Adenoma Formation
Angiocrine factors modulate tumor proliferation and motility through EphA2 repression of Slit2 tumor suppressor function in endothelium.
The neuronal repellent SLIT2 is a target for repression by EZH2 in prostate cancer.
Beggs A, Jones A, Shepherd N, Arnaout A, Finlayson C, Abulafi A, Morton D, Matthews G, Hodgson S, Tomlinson I, Horwitz M
PLoS Genetics 2013 May;9(5)
PLoS Genetics 2013 May;9(5)
Angiocrine factors modulate tumor proliferation and motility through EphA2 repression of Slit2 tumor suppressor function in endothelium.
Brantley-Sieders DM, Dunaway CM, Rao M, Short S, Hwang Y, Gao Y, Li D, Jiang A, Shyr Y, Wu JY, Chen J
Cancer research 2011 Feb 1;71(3):976-87
Cancer research 2011 Feb 1;71(3):976-87
The neuronal repellent SLIT2 is a target for repression by EZH2 in prostate cancer.
Yu J, Cao Q, Yu J, Wu L, Dallol A, Li J, Chen G, Grasso C, Cao X, Lonigro RJ, Varambally S, Mehra R, Palanisamy N, Wu JY, Latif F, Chinnaiyan AM
Oncogene 2010 Sep 30;29(39):5370-80
Oncogene 2010 Sep 30;29(39):5370-80
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
- Sample type
- HUMAN