ABIN405685

antibody from antibodies-online

Targeting: VSIG8

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

ABIN405685

Provider

antibodies-online

Product name

anti-V-Set and Immunoglobulin Domain Containing 8 (VSIG8) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-VSIG8 antibody: synthetic peptide directed towards the N terminal of human VSIG8

Reactivity

Human, Mouse, Rat, Bovine, Canine

Host

Rabbit

Antigen sequence

HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQ
YDASI NLMNLQVSDT


Vial size

50 µg

References

Submitted references

Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.

Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA, Mammalian Gene Collection Program Team
Proceedings of the National Academy of Sciences of the United States of America 2002 Dec 24;99(26):16899-903

Western blot

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Image(s): Western Blotting