Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003043-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003043-M01, RRID:AB_489792
- Product name
- HBB monoclonal antibody (M01), clone 2H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HBB.
- Antigen sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAF
SDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLL
GNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANAL
PHKYH- Isotype
- IgG
- Antibody clone number
- 2H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel transgenic mouse model produced from lentiviral germline integration for the study of beta-thalassemia gene therapy.
Restoration of the balanced alpha/beta-globin gene expression in beta654-thalassemia mice using combined RNAi and antisense RNA approach.
Li W, Xie S, Guo X, Gong X, Wang S, Lin D, Zhang J, Ren Z, Huang S, Zeng F, Zeng Y
Haematologica 2008 Mar;93(3):356-62
Haematologica 2008 Mar;93(3):356-62
Restoration of the balanced alpha/beta-globin gene expression in beta654-thalassemia mice using combined RNAi and antisense RNA approach.
Xie SY, Ren ZR, Zhang JZ, Guo XB, Wang QX, Wang S, Lin D, Gong XL, Li W, Huang SZ, Zeng F, Zeng YT
Human molecular genetics 2007 Nov 1;16(21):2616-25
Human molecular genetics 2007 Nov 1;16(21):2616-25
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HBB is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
