Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20088 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20088, RRID:AB_10965976
- Product name
- CFB polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant CFB.
- Antigen sequence
KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAV
VSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEI
EVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNK
LKYG- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with CFB polyclonal antibody (Cat # PAB20088).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of cell lysates with CFB polyclonal antibody (Cat # PAB20088).Lane 1 : NIH/3T3Lane 2 : NBT-II
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate with CFB polyclonal antibody (Cat # PAB20088) shows strong cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)